DPCstruct | MC45758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 309 ± 34 aa |
| Standard deviation of domain lengths | 34.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8T1V1 | 14-314 | DQDQYDVAAQWAKTFLHNSTDDVAIKMSQLVMACVAMGDFKTRAYMSKSSELQAPSDQLTVADYLSHASRIILDYQDMSESNRAELL… |
| A0A1Q4RKN1 | 604-883 | AASRQAIYNRDRDIWIYTLNEPSQAAKARIPGTQQQQQQLLITNTAVRRILQRIFALLHLGLTYRNGNNPYQAWTQHVAVALSHGGR… |
| A0A4Q3DJF0 | 52-368 | None |
| A0A0W0YFG2 | 24-320 | None |
| A0A4R7VZ11 | 163-482 | None |
| A0A150QEI2 | 142-462 | None |
| D9XGB3 | 237-552 | None |
| A0A1I6UD71 | 123-424 | None |
| A0A378LPB4 | 15-314 | None |
| H1WCL2 | 436-736 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.