DPCstruct | MC4575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 327 ± 54 aa |
| Standard deviation of domain lengths | 53.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285LD75 | 1-341 | MSQIKVDPSVYYNASKSLSGLTTDIQSAVNEIMTPGLNATLGMGGHYAAVKGWNTSYKKHCEDLVGTISAYAAATQQLADVLNLAGH… |
| A0A7W1STA9 | 5-364 | AAGFSVQIEDLRAAADAFARLSADAAGLLRTADLTGTGGMAGQDPVLVAWRGRYDAMAAAAWAASITATTTLGAIATKLTDTADTYL… |
| A0A1I9ZF58 | 1-218 | None |
| A0A2N3SIC3 | 6-429 | None |
| A0A4S8QGW2 | 29-565 | None |
| A0A4S8QBK1 | 1-360 | None |
| A0A286ENM5 | 3-358 | None |
| A0A5A7S7K5 | 1-279 | None |
| A0A7W9LI88 | 30-327 | None |
| A0A4R8RTJ5 | 101-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.