DPCstruct | MC45747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 19.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522HH34 | 1-142 | MFDSPLNIVLTVLIVWMLLMFLPGAFEWLFVKANYTASNAQECRASSGACWAFIAAKHRLILFGTYPYEQQWRPLLATIVLIAVIIC… |
| A0A4R4GZ45 | 2-107 | LLTAAFIYWLSSILMPWMFNGVWDANSIRDCREILDGAIGGCFAVIAERWPQLIFGNYPNEEYWRAVLAFVGLFVALAPVLFFKLPR… |
| A0A1B7I9D5 | 2-108 | None |
| A0A090P1M2 | 1-152 | None |
| A0A2L0HBM8 | 2-130 | None |
| A0A7X2FXV7 | 2-157 | None |
| A0A553ANJ0 | 5-116 | None |
| A0A6N8Q2R0 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.