DPCstruct | MC4574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 150 ± 23 aa |
| Standard deviation of domain lengths | 23.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1Q480 | 21-172 | VAAAALRRAAITGEAHAVARPVDLESVPDVLRGKLEFASGEEGREAEHLEHLLRRATADTARARLRGLDLTPLAEAVSQAPVRTGER… |
| X8C3S6 | 42-184 | AAARHRGAVLGETDPVARVVDLGTIIDVLRGKLEFESGEEGREQAVLEHLLRRATADTAAKVLGGIDVGPLVAAVEAGSAVTTGERV… |
| A0A6M1T779 | 161-321 | None |
| A0A838MTN6 | 11-150 | None |
| A0A538AGD6 | 3-140 | None |
| A0A7Y2HQX8 | 1-131 | None |
| A0A7W1R8J2 | 100-266 | None |
| A0A534VJ63 | 98-243 | None |
| A0A7C2GJH5 | 64-207 | None |
| A0A812LA89 | 531-691 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.