DPCstruct | MC4573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R2MS47 | 90-181 | LDENNRRLDVDREIATLWNVMDEGESWYLDDNIAANNPKNLTVDKDDEDFHESNKFHVINGEITALDSGFDMNQCDLVAWYLLSLGG… |
| A0A2Y9IML8 | 157-250 | LDENSPPQRKDVDNDFFLFFSVVDENLSWHIDENIVTYCSDPTSVDKEDAAFQESNRMHAINGFVFGNLPDLSMCSQKRVAWHLFGM… |
| A0A498M835 | 220-308 | None |
| A0A0S7KTP0 | 144-230 | None |
| A0A4Z2EBX7 | 102-181 | None |
| A0A402EBP0 | 1-89 | None |
| A0A1U8CVM4 | 41-138 | None |
| A0A2C9LN91 | 1-102 | None |
| L5LCJ5 | 91-186 | None |
| A0A0D2A6I2 | 219-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.