DPCstruct | MC45729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 21.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 49.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438DLV0 | 9-154 | LLIILLCFVAGVTQIDAESRTCTNRNSPCFLKRITCPSECPTSSSTNSKAKVCYINCNSPLCQAECKNRKANCNSPGAACLDPRFIG… |
| A0A2R6PRN0 | 22-143 | QKRQRATCIDRTSRCFLRPFTCPQECPSLKPTDPKAKACYINCNSRTCSSQCRGRVPKCNGFGAACYDPRFVGGDGVIFYFRGKSNE… |
| A0A4S4ENS2 | 158-310 | None |
| A0A0E0PGG2 | 1-156 | None |
| A0A7I8KJ82 | 32-158 | None |
| A0A453DRB9 | 3-107 | None |
| A0A165XTE5 | 538-713 | None |
| A0A803Q0F7 | 918-1061 | None |
| A0A446MCX0 | 15-143 | None |
| A0A1R3HUF4 | 279-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.