DPCstruct | MC45725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 200 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 25.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 99.53 |
| Assigned Pfam label(s) | CL0123- PF02178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4KD05 | 4-139 | TTASAPKAKSPKKAGGNAKTKPSHPPSATMVNAAIRTLKERGGSSLQAIKKYISSTYKVDAEKLAPFIRKYIKGAVTSGELVQTKGS… |
| A0A161ZRK9 | 1-83 | MVLMMNAQPSTYKPFHPSYEEMIFHAICSLKRRNGSSSFAIAKFILKHYGGLPKNFRKILLHRLKELVACQKLIRVKNSFKLP |
| A0A7N0UDY3 | 51-174 | None |
| A0A2U1QIG5 | 1-122 | None |
| A0A670J2J1 | 103-263 | None |
| A0A6V7WX66 | 28-180 | None |
| A0A4W6D0R4 | 11-110 | None |
| A0A4W6DCW3 | 1-130 | None |
| A0A397SNU5 | 8-140 | None |
| A0A3P9HSL3 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.