DPCstruct | MC45724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818FGT8 | 38-133 | YVQASKQSRKFISTPNDYSYAIISDTNTHLYIYKQNSPTSNLSGSSLRNRKSGKLVENIAKQHMISLENHNEILGLITTNERTYILT… |
| A0A444TMT4 | 368-460 | YVKASKSMAKYTQASPNNSYVAVADLKSHVYVFFQKESLGGELRNRKSGKVSTSIARQLIISLRNHDQVMGFYCSLDHIFVLTASEL… |
| A0A6L5DBQ0 | 175-268 | None |
| A0A6A4W3V5 | 311-403 | None |
| A0A2D4L664 | 225-317 | None |
| A0A2T7NIB0 | 422-509 | None |
| A0A183C8L7 | 123-227 | None |
| A0A183CQY9 | 56-160 | None |
| A0A2I0UU27 | 278-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.