DPCstruct | MC4571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 14.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G2M4X4 | 1-80 | MAIRNTVLEAWMTEHGYSSNGLADAVNSAVEELTGHMGGLDGSSIRAWKAGRVTWPKSATRAALEMVTGLPPVALGFVPR |
| A0A7V9BXN5 | 23-128 | HNERLRAARERTPSGRAPGECMSRSELAEAVNAWLWRCTGRRYELDGHHIAKYERAVVRYPIAPYRAGLRAVLDAVTDTALGFVPPS… |
| A0A132MTC2 | 5-87 | None |
| A0A4P6Q9X0 | 1-108 | None |
| A0A840QF79 | 2-100 | None |
| A0A4D4K8T2 | 1-124 | None |
| A0A1Q5CUH0 | 1-103 | None |
| A0A4Y8LUR3 | 6-123 | None |
| A0A7X6M2Y1 | 5-81 | None |
| A0A4R8A1S0 | 28-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.