DPCstruct | MC45705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7KRW6 | 19-111 | GRDQVKLHERIVIGIILWNSVVFLLYFLDKAKARHGRWRIPERVLLWIAVLGGGPGAFMGMQLFRHKTRHTRFRIIIPLAAILQLTL… |
| A0A0D5NMZ4 | 3-89 | VALFTLYIAIINIAAFAMFGSDKAAARKNRRRIPEKRLFLVSAAGGSMGALIGMRIWRHKTKHASFTIGIPLLLLLNLALGALFVRS |
| I7LPP2 | 2-72 | None |
| A0A2R7SBC5 | 67-170 | None |
| A0A3M1GL05 | 145-245 | None |
| A0A3N1X850 | 117-225 | None |
| A0A656GRQ9 | 2-84 | None |
| A0A507F5R8 | 295-389 | None |
| A0A517L4Z7 | 33-153 | None |
| A0A7V8FP84 | 67-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.