DPCstruct | MC45703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 130 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7HJI9 | 7-142 | HISFLQSALTTENPLMPSARFHLWMREMNENVHVKIDRVPFSRMRAWYFNEDMGNLVHESGSFFSIEGIRIRTNWGKLSEREQPIIN… |
| A0A7V8BUG7 | 3-139 | EQLLQSFEVPLPASGHAAAVAKLVEVREACALQVSAVPLQALPGWQCNDWAIECEQPRTDPVVRPFRVHSADREVKHWCQPLLTNRA… |
| A0A1T2CHF7 | 27-156 | None |
| A0A4R4UBZ3 | 156-277 | None |
| A0A0G0KT25 | 23-173 | None |
| G2G4Q3 | 1-100 | None |
| A0A2X5C9S6 | 37-135 | None |
| A0A239ME51 | 2-134 | None |
| A0A075H6P5 | 1-106 | None |
| A0A7X0D7E3 | 4-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.