DPCstruct | MC45702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7HII0 | 1-140 | MMAIQDFNQPYEILWNTDVEGNPITVLIENESHTITDNMIILAQLPSESNKPTITGKYEVPLNSVLSSADYFKVDYRNGVIYFHSSL… |
| A0A6V8M8K2 | 1-139 | MTLEKNISPILNRLRSGMEGDEFVVYTNVPETVVDGRVQLSEIPDRVQKVQVIDLEANTHYYETQNEYPSELQYVVDYNTGIIKYNS… |
| A0A7Z2VEW2 | 1-135 | None |
| A0A1V4H8P1 | 5-130 | None |
| A0A4Y6USD3 | 1-118 | None |
| W7YSI1 | 1-135 | None |
| A0A7Z2ZLF8 | 1-127 | None |
| A0A3Q9RPA4 | 1-123 | None |
| A0A401UQM0 | 1-145 | None |
| A0A848RKL6 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.