DPCstruct | MC457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 6 aa |
| Standard deviation of domain lengths | 5.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418NW86 | 86-199 | VVDPLDVSIIESARAMLVSEDMWNRQDDRNCDRAQPRISLFCALRFASVDVTGTYNHRRAALQEARIAVQDAVHDRDYAHRLRDFNN… |
| A0A1F3A108 | 63-181 | QESRRRYVDAADLEILDGAAAILSRSDAWDRADDRECGAQDVKFSLFCALKRASELSTGEYEHRRTALQEVRFAIEDLRPGVEYEHR… |
| A0A5B7X0R1 | 379-495 | None |
| A0A369QMJ9 | 123-241 | None |
| A0A162CLC9 | 141-248 | None |
| A0A662BW66 | 374-485 | None |
| A0A1Y2R9R4 | 170-284 | None |
| A0A6B3W4T6 | 511-629 | None |
| A0A523FRQ7 | 18-141 | None |
| A0A537ACP1 | 96-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.