DPCstruct | MC45699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 296 ± 57 aa |
| Standard deviation of domain lengths | 56.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 79.42 |
| Assigned Pfam label(s) | PF00591- CL0105- PF02467- PF02885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2X8M5 | 2-323 | VQLIEDLISGKDLTESESEDSLDFLLNGADEALISAFLVLLRAKGETFEEVVGLARAMIKHCRQVEGLGDAVDIVGTGGDGANTVNI… |
| A0A318DGC6 | 1-232 | MTYDETKKSFESLFNNEMNVNEMRDFLLSMKLDEYTSVESIAAAAEVMRSHALSLPVSEEIRLKAMDIVGTGGDKIGSFNISSTVAI… |
| A0A7V0I9G6 | 89-329 | None |
| A9WME3 | 141-335 | None |
| D9UK05 | 154-435 | None |
| A0A7X0FYZ6 | 28-254 | None |
| A0A7N0TZR1 | 65-257 | None |
| R7AV87 | 2-233 | None |
| A0A485A5S2 | 130-313 | None |
| A0A820ZFE8 | 2-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.