DPCstruct | MC45691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 59.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T1CRK4 | 3-69 | PLRVGVAGPVGSGKTALVEVLCKRLRQRLHMAVVTNDIYTREDAEFLLRSGALPSERIRGVETGGCP |
| A0A4R6ZW81 | 6-69 | RHVLRVGVGGPVGSGKTALVDALCKLMRERYEIGVVTNDIYTREDQQFLIRSQALPEERIMGVE |
| X7XZ92 | 1-60 | None |
| A0A7E4RZQ9 | 249-311 | None |
| A0A6A6M0E9 | 436-497 | None |
| A0A5D2EW41 | 84-145 | None |
| A0A7Z6L829 | 4-72 | None |
| A0A0W8C106 | 98-159 | None |
| A0A0C4FD08 | 1-60 | None |
| A0A3F2RDW3 | 533-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.