DPCstruct | MC45690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 265 |
|---|---|
| Mean domain length (aa) | 222 ± 57 aa |
| Standard deviation of domain lengths | 57.34 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.92 |
| Pfam Score | 46.51 |
| Assigned Pfam label(s) | CL0023- PF08118- CL0760- CL0401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1BI03 | 28-277 | YRARVKKIYFSTSQRKIILDKVTLLPRYNRVDFYKQTGEAGDIYTLKFKRAAINNIDLQRFFRDQKLYAGTMDITSPDVQIYANNAF… |
| A0A2R7Q3J3 | 2-243 | KKIIYILLGLALAALVSIVALVSLIDPNQFKPQLVDQVRKSTGRELVIQGDIGWRFWPSLGLSLEKVALRNPAGFAEPDLVRFERGQ… |
| A0A379UUI8 | 1-135 | None |
| A0A356FV58 | 181-412 | None |
| A0A3G2G2L3 | 23-273 | None |
| A0A0F7S270 | 726-929 | None |
| A0A2R7RVJ8 | 20-176 | None |
| A0A0M4KI52 | 634-871 | None |
| A0A538QSC6 | 3-211 | None |
| A0A2K2Z8X8 | 1-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.