DPCstruct | MC45687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 182 |
|---|---|
| Mean domain length (aa) | 201 ± 42 aa |
| Standard deviation of domain lengths | 41.73 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5NTV8 | 5-226 | RNNDKLKEMLKQSQRDFSFDQKAVKQTVLAHAGTHQPVLLAKSYRLAWAYTFAALMLFIGLGTTLTYANTAKPGDRLYAMDTLHEQA… |
| A0A0F9H9K3 | 125-277 | TILPDSPFYFLKNLGRGIRTFFTFNPLAKTELREKFANEKLMELKRMVEMNKSANAIRSAAQNYQEEVETVKKFAERIRTTAQENEQ… |
| A0A845U1K3 | 6-179 | None |
| A0A7C4L1E7 | 35-262 | None |
| A0A0G0NBW1 | 3-132 | None |
| A0A1F8P9T9 | 92-266 | None |
| A0A1G2RKD7 | 662-799 | None |
| A0A1G2VKT4 | 159-446 | None |
| A0A1F6CQM8 | 3-180 | None |
| A0A1F7VE87 | 16-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.