DPCstruct | MC45682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 193 ± 17 aa |
| Standard deviation of domain lengths | 17.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3ZT04 | 5-184 | VNYGILTSVDWNSKKWQAQSDEDLPHVDFGFVKENGITFTSLNFGQDLFPSDEKGYYSGLLPQLYTKTLDKKKSKNLLVVFIKSKDW… |
| A0A497F5W0 | 1-199 | MSEVIVWKVLWSSNGYRGWDDRVYREFFLGGRAGGLGFKFFAEYGFGFEWWNFYEGFSDDFYFGYAPPVHAMRPRKFRSGGLVFFIS… |
| R7FEL8 | 4-211 | None |
| A0A7C6RQW8 | 1-143 | None |
| S5ZKR7 | 1-208 | None |
| A0A1V5XGY7 | 190-379 | None |
| A0A7H8VFT6 | 2-186 | None |
| A0A4R7DZE1 | 108-294 | None |
| A0A3N6AF89 | 1-212 | None |
| A0A415NU30 | 60-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.