DPCstruct | MC4568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 5.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8YIA3 | 1-85 | MTPTGFTTSPGTALLLPRLLSGRGRGPVFLADRRPTRAVPGLDLCPVTGHARLSYRRAAELFEHASQPLAGYCGTGPQLNVAPAT |
| A0A1M5D6R0 | 26-112 | LGQTSIRWRTATAQLLPHLIAGRTRGPLFLSDRRPAPARRPAETDLCPETGRRRLSYERAEYLFKQATTTLDPTGAGYTLRQLRPRA |
| Q5YM76 | 10-86 | None |
| A0A4D4KMP1 | 6-80 | None |
| A0A1I5X2M4 | 144-229 | None |
| D9UI49 | 1-75 | None |
| A0A4R5B5I7 | 106-178 | None |
| A0A1G9IUH5 | 175-250 | None |
| A0A561UXV6 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.