DPCstruct | MC45679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4950 |
|---|---|
| Mean domain length (aa) | 212 ± 53 aa |
| Standard deviation of domain lengths | 53.47 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.63 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF00137- CL0213- CL0221- CL0617- PF03080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S1NEC6 | 5-228 | FCNMNFWKPVYDMKFSEKQEYLVEKVKNEEPVILAINEHASHQTLISNLDKMLGGEYSVVKPNFDNVSHPRSLQNLLIIKDGIKYTI… |
| A0A7Y5XDP8 | 132-393 | VRVASFNTLNWFTTLDRRGADTAEEQERQLAKLTAALRGLDADVVGLMEVENNGDTAVGAIVDRLNRAAGAGTYTWVRHPYPGTDEI… |
| A0A821W418 | 270-457 | None |
| A0A821UG12 | 2-142 | None |
| A0A4V2EUF6 | 36-209 | None |
| A0A5N6Q9B3 | 42-259 | None |
| A0A820EH38 | 7-151 | None |
| A0A086KED1 | 463-820 | None |
| A0A1Y2HJG3 | 498-775 | None |
| A0A2N9IMN5 | 119-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.