DPCstruct | MC45671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 271 ± 29 aa |
| Standard deviation of domain lengths | 28.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020- PF21046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316UIC7 | 884-1131 | YLKSIFEAPGTIAIFLDVKRPAETIRRFVRLLTQLVQYPDMWKTLVVCKFDPDLQVGLPALVYQSRTPLLDLLAKHLVDLRHNQSTF… |
| A0A0C3EF66 | 2-257 | ESLCWNIPEDLEEQLAVIARSPRVLSILLDSAQPPWLWSKCARLLVFISTRPNLFRSLLSYPDPETPAREEAPKEFTKVPHIERLCS… |
| A0A2N6NW82 | 1-281 | None |
| A0A842YU24 | 122-386 | None |
| A0A135U123 | 429-711 | None |
| A0A2H3IQZ1 | 485-731 | None |
| A0A022WBP2 | 365-611 | None |
| A0A0C2J1M2 | 49-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.