DPCstruct | MC4567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7A7S3 | 100-227 | PAEQFNLIGYSYGSLMAAQTAHVYARNGHIVDHLVLIASPIDRDFLEKLQTNRNIKRVIIIDLREYKDPIFAGMSQWRLILSKSTLE… |
| A0A7K1Y3Z5 | 16-143 | KPLKEGEQFNLVGYSYGSVLQAQAALKLAKSGQVIDNLVLIGSPISTDSDLYKQLSENGNIKSILRYDLPGDALSNSDGIMDILKGA… |
| A0A0N4ZHB3 | 699-841 | None |
| W6KGG6 | 82-195 | None |
| A0A6A7Z5V3 | 216-341 | None |
| A0A423JCT8 | 179-301 | None |
| A0A375G9Y9 | 2-111 | None |
| A0A1Y0FIT8 | 14-142 | None |
| A0A1I1GP02 | 181-336 | None |
| A0A5N7RXS5 | 133-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.