DPCstruct | MC45666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 72 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.57 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | CL0010- PF13908 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212CQK1 | 32-110 | VSTMDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDHGTRTNYRAGYQGAHDLLL |
| A0A060XR93 | 150-215 | GIFTGGRVVRGVDWQWEDQDGGNGRRGKVTEIQDWSAASPHSAAYVLWDNGAKNLYRVGFEGMSDL |
| K3WUM2 | 631-718 | None |
| A0A6P8H7F8 | 1-72 | None |
| A0A7M5UTY2 | 133-203 | None |
| A0A6P8GZX4 | 1-73 | None |
| K1PIC0 | 402-468 | None |
| A0A183WGG8 | 11-88 | None |
| A0A4Y2LV21 | 156-221 | None |
| K1PHD2 | 149-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.