DPCstruct | MC45663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 312 ± 46 aa |
| Standard deviation of domain lengths | 46.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212CH69 | 1-315 | MVGRNWMCFGSVKIFKSSHLPVGDRFEEPLANLLNEQHCTVKELLEQLKMKKSSAKQQQEVERVKPQREKVHQTLILDPAQRKRLQQ… |
| A0A834HZZ8 | 356-646 | QLKLKGQPENVTKEPKVVQIQQHQLNILEQQMRQHIQMLTQNFLLTYSVPGFHEKSFQFRDHLMDLKKHADGRDMSVFKQSNLLPAI… |
| S4RI38 | 351-659 | None |
| A0A7F8QWR9 | 1-373 | None |
| T1HBD0 | 272-495 | None |
| A0A044T8H3 | 375-629 | None |
| A0A6I9JFY5 | 23-353 | None |
| B2RCN4 | 23-264 | None |
| A0A7J6ACD1 | 1-356 | None |
| A0A060XEF6 | 537-853 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.