DPCstruct | MC4566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M6KAE6 | 68-147 | RELGLGIKHEELKKYLSSSFPERLSGKILLDVEQNGEAYYVNPADLKGYFLNRPNDAFSVMREKGLGITNNDLWKITLSG |
| A0A1G2AZS6 | 16-86 | DTATGDRALRTRLSGRILLQVQQHGEAWYVYPGDLKRYYLGRPSDAFALMSNLGLGISATDLGQIPISTNF |
| A0A2G9ZKX8 | 452-537 | None |
| A0A2G9ZNU9 | 182-268 | None |
| A0A0G0IHT1 | 1-88 | None |
| A0A1V6DYD3 | 619-698 | None |
| A0A2H0ND97 | 334-432 | None |
| A0A0G1SPX6 | 25-94 | None |
| A0A2M7Q934 | 21-92 | None |
| A0A0G0K4E1 | 70-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.