DPCstruct | MC45646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 27.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X992 | 1-121 | MEHESSSTATTSLSATKASKKPSNRKLIQNALEYTLLAGGSMERDRLAALQAMTLSTCENFIVLLKSTRELKFRALYEHHTDRQHVV… |
| A0A2H1CXY7 | 209-313 | TSGPGVSVAGQPKLFVKPKAKSNRMVIVNAIGHCCLAGAVNEPMKQATLKELASTEGTHFMILFRDSRCQYRAVYAYDLESEELHLI… |
| V6LLE3 | 427-599 | None |
| A0A1R2D0S2 | 21-200 | None |
| A0A1R2CWS7 | 120-286 | None |
| A2FZI3 | 616-788 | None |
| B4GZX0 | 90-205 | None |
| A0A183WHC0 | 11-114 | None |
| A0A5K3EVV5 | 593-753 | None |
| C1MII2 | 853-1015 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.