DPCstruct | MC45645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X7Y4 | 6-141 | TFKQLLYYVRSGADAAYVLDLTLRITDLARLRKISHYLSTNTELSGSKAVRRQLAEQWYASCKVPANIRHLVSKWDCSKYDDVSGHA… |
| A0A6A3XVN0 | 92-229 | DGHASFYKLLELLRSEAPPEHIYQMLVRIYELSKHSRFEEYQKGLEDMENEGEKKKLLAEWVDLMPTQLLERYACYEAKWDFSARED… |
| A0A6A3JD13 | 114-239 | None |
| Q572K2 | 1-144 | None |
| A0A6A3R6M0 | 110-252 | None |
| A0A6A3Q8V6 | 2-120 | None |
| D0P0G0 | 101-262 | None |
| A0A6A3I3S8 | 91-254 | None |
| A0A6A3IKA0 | 15-166 | None |
| A0A6A3DPG1 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.