DPCstruct | MC45643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 160 ± 27 aa |
| Standard deviation of domain lengths | 27.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X7K3 | 37-199 | DEEMKGDEEMKDEDDEDEEETKEDEVWGEEQPLVGSGMAATLALLRKTGDLRETRVERQAGRANDARDRNVDEELRIKDGVKLDYRD… |
| A0A6G0UJ76 | 74-251 | KEETEYVNVLGQEKDVTKGVAGMLKLASEKGYLEDPNAKKNKGGTLKHLESKCFAKVEFSKYDIEDKYLKKMERLGTTGSGPLRTFL… |
| A0A7J0ER17 | 18-177 | None |
| A0A0P0VJK6 | 139-293 | None |
| A0A540K2J1 | 181-302 | None |
| S4RLI1 | 245-409 | None |
| A0A4U5P0S7 | 675-835 | None |
| A0A7S2MYK3 | 11-156 | None |
| A0A6U5KKA7 | 61-265 | None |
| H3ASQ1 | 466-636 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.