DPCstruct | MC4564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 62.28 |
| Pfam Score | 93.55 |
| Assigned Pfam label(s) | CL0129- PF00203 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834NZ33 | 1-74 | MAEADETQKKKRTFRKFTFRGVDLDQLLDMPNEQLMDLMHARARRRFSHGLKRKSMALVKKLRKAKKETPPNEK |
| A0A813H194 | 133-221 | KKKRTFRKYSYRGIDLDKLLDLSNQDLMELFRARQRRKFSRGIKRKPITVLKKLRKAKRDTAYGEKPEAVKTHLRNMVIVPEMIGSV… |
| A0A0V1BVR6 | 73-151 | None |
| A0A6P4PBG2 | 3-75 | None |
| A0A835J0J1 | 10-86 | None |
| A0A835IHH2 | 7-77 | None |
| A0A643C6X2 | 9-110 | None |
| B9F6H3 | 263-349 | None |
| A0A5N6PGC9 | 473-549 | None |
| A0A1X7T215 | 3-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.