DPCstruct | MC45639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00964 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X1J0 | 8-116 | VWTAIAVAVMLFSAPQAATADCGTEEIIPKLLPLLGDSDFDACQQATGYVFYPFAGLPTESQMKDLCTSEVCQSLLTTVVDADLPRC… |
| P0C231 | 2-97 | ACTTTQQTAAYVALVSILSDDNFSQCSTDSGYSMLTATALPTTEQYTKMCASTACQAMIANIITLNPPDCELTVPTSGLVLNVYEYA… |
| Q2N060 | 1-114 | None |
| Q2N078 | 67-184 | None |
| F0W6W4 | 27-148 | None |
| A0A0A7CLG7 | 1-137 | None |
| W2INC2 | 271-380 | None |
| G4ZXI9 | 7-118 | None |
| K3WFY5 | 8-135 | None |
| K3WVC2 | 5-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.