DPCstruct | MC45638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X113 | 19-136 | TLQSAAARPEYVEMLPNGANTGVEALGHTNHIGGGSLTAFGEDFAVAGHKWTKALCEKDSDGDGQTNGQELGDPCCAWTLKTYQRVE… |
| A0A1I8G570 | 24-132 | AFKTLQAKIPNGANVNNPCQAGTQWPGVGHWNKDGGGERNPFGIAFKSNGFVWNSTICQLDSDQDGRSNGEELGDPQCVWTEGGTPE… |
| A0A2C9JWX0 | 4-114 | None |
| A0A1I8HY55 | 13-129 | None |
| A0A1I8IQX8 | 852-963 | None |
| A0A524PU46 | 8-119 | None |
| V4BSQ6 | 11-127 | None |
| A0A2P4YM16 | 3-112 | None |
| K3X5B1 | 2-99 | None |
| R1BPV6 | 5-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.