DPCstruct | MC45633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 98 ± 20 aa |
| Standard deviation of domain lengths | 19.65 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6W2F8 | 2-97 | STVIMQAQKEAPPDMQCKDKFLLQSVVASPGATAKDITSEMFNKESEHHVEECKLRVIYVAPPRPPSPVREGSEEGLSPRASVSDNG… |
| A0A2Z6MM41 | 1-70 | MEPQEKAPPNMQCKDSFLFQTVFVRPKATIKDITLETFEKNSGYEVKELIMPVVYVAPPKPPSLSSHKNY |
| A0A6A6LJR1 | 18-99 | None |
| A0A444WUC5 | 77-193 | None |
| A0A0K9QS74 | 1-89 | None |
| A0A7J9HTR6 | 1-93 | None |
| A0A1S4A658 | 59-131 | None |
| A0A445M302 | 1-108 | None |
| A0A0E0HDL0 | 17-130 | None |
| A0A833V5C9 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.