DPCstruct | MC4563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 73.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9M5R2 | 115-173 | QYSHAFNSYTWNDTAHTDWIPDDVLTVTYEDGKWSKPYYDCGGGNIWMLTYTVPFFGYK |
| A0A834NS38 | 11-84 | IYTTEFSEDICASLHTYTYNESTHTEREEDEILTVKYEDGRWSKPYYDCGGGNIWMLTYTVPFFGYVNDTYFFK |
| A0A310SGD0 | 91-170 | None |
| A0A026WWY2 | 649-715 | None |
| W5JKZ5 | 4-71 | None |
| A0A6P3Y7S2 | 550-615 | None |
| A0A182FH55 | 1-66 | None |
| A0A482WKP8 | 113-187 | None |
| A8DY43 | 557-626 | None |
| E9J085 | 7-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.