DPCstruct | MC45625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5LU93 | 22-98 | QELVYMEKFCLKVGFNERQITTLISGKPLFYEGELYSEEHRRKFKTERAGFQVVKDPTDKAKFALAINGQLIGEWFK |
| A0A8B3B816 | 8-92 | REMLRIENLCRLIGFDERQTATLVKGKPLEYAGELYSEEHGRKFTTERAGFQVLKDPTDGTKLVLSINRKPIAEWFKEQFEKLRQ |
| A0A8B1ZPC0 | 344-430 | None |
| A0A1Q6GLJ6 | 16-90 | None |
| A0A0A2F6G8 | 248-329 | None |
| A0A069SK09 | 62-143 | None |
| A0A2K9H3L6 | 40-121 | None |
| A0A7K0ALT1 | 26-112 | None |
| R5PGR5 | 2-81 | None |
| A0A5J4SUG3 | 10-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.