DPCstruct | MC4562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6MGX3 | 1-77 | MSGQSSGSGFLMSAVVHGDSLLNEQEKELSQRLRRLYPAVNENETPLPRSWSPKDKFRYVGLSQNNLRVHYKGHGKT |
| A0A834NR02 | 1-66 | MAATSEERIVMEPSRTNCGQTQVVDRLKMLYPMVNEEETPLPRSWSPKDKYNYIGLSQNNLRVHYK |
| A0A1I7WTR8 | 6-73 | None |
| A0A8B6CKG1 | 2-68 | None |
| A0A182WB84 | 38-110 | None |
| A0A7R9ASK1 | 1-67 | None |
| A0A6L5CKK6 | 1-57 | None |
| A0A670K0P8 | 58-133 | None |
| K1RJX7 | 1-63 | None |
| A0A1B0D050 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.