DPCstruct | MC45614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 275 |
|---|---|
| Mean domain length (aa) | 213 ± 44 aa |
| Standard deviation of domain lengths | 44.11 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 92.44 |
| Assigned Pfam label(s) | PF00263- PF03958- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357NED2 | 32-226 | DKSAGSAGRSTDTAGANKEYGSAHLFKTVNVGVAAMLKAKIGKGEGKVLAKPRIIALNSKDAHIHIGRKLPVVEYDKDGNKTVSYIE… |
| A0A847I3Q6 | 30-260 | AQTLPLSVPIDAQLIILHVQTPRAARDQLNRVWDLVREDSVDSETAVRLYSNGVRMGVGQIARWDAIKDIFDATEKSRVYELPPMVN… |
| A0A800JC89 | 13-196 | None |
| A0A2S0PBI7 | 32-256 | None |
| A0A1Y6B5G5 | 805-1048 | None |
| A0A800JE71 | 1-141 | None |
| A0A3E0PKQ7 | 955-1265 | None |
| A0A7X1AX54 | 637-855 | None |
| A0A848WSB5 | 52-270 | None |
| A0A3D1F9Z6 | 103-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.