DPCstruct | MC45609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060QFP0 | 1032-1120 | ETIRRAHPDVIGTQEIFQSQADAVIKALPKYRWFGLDRFGAHTSEHMGIFYDPTRLCLLEHGQFWLSKTPDKPGSLGWGAPLPRSAN… |
| A0A5J4R9F8 | 65-153 | NMIQKEAPSVFGLQEALFEQVQYIEKLFTQYTRIGVGRDDGRDEGEIMAIFYLKEYYELIDHGTIWLSETPTKVSKGWDAQCNRTLT… |
| A0A0E9LVK3 | 83-171 | None |
| A0A4D9A5D6 | 35-113 | None |
| A0A0P0WK27 | 35-126 | None |
| A0A819BHC8 | 38-127 | None |
| A0A2S4UYR2 | 53-134 | None |
| A0A2D5BTM4 | 219-307 | None |
| A0A452Y991 | 12-89 | None |
| A0A452Y984 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.