DPCstruct | MC4560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 249 ± 35 aa |
| Standard deviation of domain lengths | 35.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13863 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672IEI4 | 2-175 | QKAEREREEVLQREVEMKRLQKEYSEMMEKKQEMLRQVQRYSIYKDFMDDHVDRLLHVKQQLWEKASETQEKVDQQRKAAAVLEDQR… |
| A0A6P7K194 | 19-278 | ESDSELLDLPNNHAELQELKAKYEEELKALGKREEELTRDNECKEDLIKRFSSSLKDKTAALAEWEKREVFQKQAQLETLKEEIAQL… |
| A0A3P8Y5C8 | 2-215 | None |
| J3QPZ5 | 5-296 | None |
| A0A670ZWA6 | 47-279 | None |
| G1RG69 | 29-309 | None |
| A0A2P8YAK6 | 10-258 | None |
| A0A672V5B4 | 36-308 | None |
| A0A0D2N5V2 | 12-277 | None |
| A0A3Q1J5E1 | 3-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.