DPCstruct | MC456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 198 ± 28 aa |
| Standard deviation of domain lengths | 28.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6Y0K2 | 1-198 | MDWASQITENLLAAVALGLSLVSLIVSLTTYFFTEAREQRVEKSAAYLDLEVQSGVAFQYAATNAELMDPLRKPERPASLPKGAEFR… |
| A0A4V3RYW2 | 1-187 | MFGLETSMEAVVAFAALLVSLVVFLLQQRKMIQLRKQENYLSLELSSNEVFRYEAEYGARLEPFMEETRPGEWTPGPGDESVAGNFY… |
| A0A1E4FXY8 | 171-337 | None |
| A0A2E5UU38 | 47-197 | None |
| A0A1W9LTF1 | 63-304 | None |
| A0A4S1XJK6 | 1-225 | None |
| A0A1J5E9Q9 | 73-271 | None |
| A0A5A7NBJ6 | 3-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.