DPCstruct | MC45598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 65 ± 10 aa |
| Standard deviation of domain lengths | 10.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0630 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1KYA2 | 15-78 | YAITVLVLILILYLTAPGQCTLQPKARVNCGYPYISSQECNRRGCCFDSSIAGVIWCFFPADTE |
| A0A1L8H5E1 | 41-93 | TASEGPLKKLECSGDPYKRKDCGFPGITEKQCKQNGCCFDPSIVGVKWCYTRT |
| A0A1S3G431 | 7-80 | None |
| A0A5F5Y806 | 6-83 | None |
| A0A803JEE6 | 354-404 | None |
| A0A5F4WGX4 | 17-96 | None |
| A0A2B4SEF9 | 640-702 | None |
| F6VM99 | 3-71 | None |
| H0W2H4 | 1-53 | None |
| A0A3M6U7M1 | 279-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.