DPCstruct | MC45597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 127 ± 28 aa |
| Standard deviation of domain lengths | 27.92 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A260BHY6 | 25-134 | ATWGEAEARLSPTRWKQIIDRLADAEIAVPENGQSFVLDDIPGHLDGDWPEWPARLMLTLVPRSIAEKYGKKADSVMNGQFLEFDAA… |
| A0A1C5IAE4 | 28-154 | TEEAAEIRALAAARTWGEARQVRMTHLWNPAGPEYHDPEDGYADDKPFTITEVGAIQDGTWPRMVTERAFTLLPQDLQDRYGKRQVT… |
| A0A418VHN2 | 2-149 | None |
| A0A5B1LHB8 | 22-167 | None |
| A0A520XZS4 | 3-178 | None |
| A0A0D0K229 | 6-111 | None |
| A0A7I7PA01 | 10-161 | None |
| A0A1R1IH55 | 3-141 | None |
| A0A165MDU4 | 1-88 | None |
| A0A5C7P3Z4 | 4-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.