DPCstruct | MC45596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 11.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838G2G1 | 183-253 | ETEGGTAGKYADSHVPLEDESQPPAGHPVKGNEDSMKYHEPDGQWYGQTTAEVWFKSAAAAEAAGFTKAGE |
| A0A3G8JLI0 | 267-325 | GAHLALDDPHEPPDGYPIKASADAGLYYPPDVSSFAEVTPQIWFASTSAAEAAHFARAE |
| A0A117ILI4 | 671-743 | None |
| A0A1X2DEP5 | 103-182 | None |
| A0A6B2DZ70 | 6-70 | None |
| A0A1Y2T5Y4 | 38-112 | None |
| A0A839RVZ4 | 585-660 | None |
| A0A0S2LWR4 | 78-141 | None |
| A0A6M6JP91 | 746-814 | None |
| A0A5Q6RRV8 | 112-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.