DPCstruct | MC45595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 216 ± 28 aa |
| Standard deviation of domain lengths | 27.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178LZV0 | 171-358 | YDEWNHALATYFTAGIPQGHVVYLSVDDAIIQQIEHQLTVRLGRSPEPFIAAVRRRVVYGQRVVFRRIWGRNRYGEPNCIAFLAAMV… |
| A0A7Y5T878 | 7-221 | YERWDRALARHIFTEESAGLPVYLEVTPEIFSAVAADLDVPGDPAEHLAKVVRETLYLEDRHGFDAHRERFQMWRRQKLAPTGTLAK… |
| H8H3M5 | 1-178 | None |
| A0A6I6G161 | 2-185 | None |
| A0A2G1UGM3 | 125-316 | None |
| A0A2D5VJK3 | 312-534 | None |
| A0A7W4W8W3 | 6-180 | None |
| A0A4T0V044 | 8-276 | None |
| T0FSH8 | 3-252 | None |
| A0A358IRZ6 | 20-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.