DPCstruct | MC45584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 287 ± 47 aa |
| Standard deviation of domain lengths | 46.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.54 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF12335- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7N4E3 | 14-288 | NGEKGPITEEIQRECKEFIEDLVDRIFNKSSTIVQEDNAKFGIYSRTTEGRALFARLVDSQRVNTKRVSEQTFYRLVQFFALCLFEC… |
| A0A6J8BX08 | 2-184 | YLYVFQYSPGRLWFARYVNSQRVHSKMVTEQIFFRLVQYFAVVLFECNEAEDFSPAKSLMNMCFTFYCQIPCGKSVEKNFLYSFLCD… |
| A0A1Y1NJD5 | 548-799 | None |
| A0A5K4EPF6 | 282-520 | None |
| A0A067CYQ4 | 336-575 | None |
| A0A812S199 | 378-682 | None |
| A0A077ZU19 | 122-408 | None |
| A0A817CFD4 | 462-789 | None |
| A0A3R7X1G4 | 16-223 | None |
| A0A1Y1NP10 | 201-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.