DPCstruct | MC4558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6UNU0 | 8-117 | YVKLQDAYISETSDSIGNWKAIGYQMNNSSVFTYSGAANTVALTTGMDSAWVATSNVALNDCEKDKKWTLNVISNDKKGGSAAYTAV… |
| A0A2C9A8T2 | 51-151 | RLQDAFVHNDHGIGSWKDIGYAAPGDGKTNNFEYGDCVVAKKEIDKDAESFLGWSATNLSALNECSARSAWGIVIDPVAESTVNFTQ… |
| A0A2N3RSX2 | 21-135 | None |
| A0A1M6PLP3 | 1-109 | None |
| A0A254SHW7 | 50-163 | None |
| A0A1X7J4W9 | 1-98 | None |
| A0A254RIF9 | 46-139 | None |
| A0A254S5X8 | 12-130 | None |
| A0A254RGJ4 | 73-169 | None |
| A0A1M7AYQ1 | 54-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.