DPCstruct | MC45570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2RG09 | 1-122 | MAYRNENGPFAKRADLKKVPRLGAKAFEQCAGFLRITGGAEPLDASSVHPEAYSVARKIVAAARGAAVSSLDPQAFVDGTFGLPTVR… |
| A0A6I6D5R9 | 502-620 | TVAKNIVNYREKEGKFKFRKDLLKVAKLGPKAYEQCAGFLRIDSAKNPLDNTAIHPESYDLTHKLLDYINSDITQLGSNSLKQKLNK… |
| A0A7Y6CMY8 | 306-413 | None |
| A0A813FLV0 | 763-867 | None |
| A0A378MYL9 | 1-71 | None |
| A0A821X720 | 904-1022 | None |
| A0A7V6XKE9 | 212-335 | None |
| A0A855HLZ7 | 1-90 | None |
| A0A7V8VBI6 | 805-924 | None |
| A0A7V3AN01 | 199-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.