DPCstruct | MC45567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 282 ± 45 aa |
| Standard deviation of domain lengths | 45.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9VXF0 | 28-291 | KSKGCGTGFAYGFLWCSLLLSVSVYVVDTFTAVQLLAFNRWSSQIEPAIGFSVSKWIFSICIILSFANLAFEGIRAYRVVRRSNIAE… |
| A0A397W8W9 | 20-257 | HKFDFVDLDEFKYTSASGKITGKINYSFVFLVILKSVLIYIADIWTAGLLLIFDRWGSAIQPKIPFYVSKWIYIGCIFASFLLLAWD… |
| A0A1X0S1P9 | 1-308 | None |
| A0A376B6F9 | 41-391 | None |
| A0A1B7TA50 | 2-267 | None |
| F4NY18 | 19-318 | None |
| A0A5C3L8L9 | 14-284 | None |
| A0A367K7X7 | 2-232 | None |
| A0A1E4SRE4 | 39-302 | None |
| A0A507E0B2 | 1-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.