DPCstruct | MC45562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8N092 | 5-125 | DQEAPVSVVAFPRQPMQNISEKGIFKSPPLRSSHFTCYQKHRTMNRRANKHYPLTCQACNRADTSDRWVCTFCSLQICDPCTRKLQG… |
| A0A1S8B467 | 26-133 | LELTSNSALVGSTLPTSELFNTQLRPERSVVPRLNCVHMQCFHNHRRFHRSNNRVLPIGCMLCFSCSPDFHWTCTWCALRICQGCRV… |
| A0A367LP33 | 420-527 | None |
| A0A1V6PNH7 | 201-304 | None |
| C4JIF4 | 71-175 | None |
| A0A384JUM9 | 183-313 | None |
| A0A074YF69 | 299-406 | None |
| A0A2V1EBK6 | 617-748 | None |
| A0A135LYA5 | 344-439 | None |
| A0A0A2J9W6 | 169-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.