DPCstruct | MC4556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 398 ± 34 aa |
| Standard deviation of domain lengths | 34.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8U6H4 | 1-327 | MGKMVDHPLLNVGHDGNYRFSFDFLASYLRALHIADAISNMGVAPSSSIWPFLREEANGKGFILEHLESLLEPEAVDSVGGLVASVP… |
| A0A1T3VPQ2 | 228-674 | ISYLLELVDDLRASSSEQDPSELTEWQIYKLIVDRLMMRDLQRSPTLLPSMRREALQKLALTLSKKEVPTATEEVFLQVINDLFRVE… |
| A0A847YW22 | 400-794 | None |
| A0A6P2TEY3 | 594-980 | None |
| D1BAG6 | 613-1068 | None |
| A0A7Y6Z7U8 | 405-777 | None |
| A9H7I2 | 35-426 | None |
| A0A2M8H8R7 | 573-951 | None |
| A0A1Q3N610 | 78-529 | None |
| A0A377RWR1 | 295-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.