DPCstruct | MC45558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 380 ± 69 aa |
| Standard deviation of domain lengths | 68.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 57.27 |
| Pfam Score | 96.21 |
| Assigned Pfam label(s) | PF00223- CL0029- PF00421- PF05695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2KKH8 | 71-447 | QITFEFFQIWRESGITSELQLYCTAIAALVFAALMLFSGWFQDVESMLNHDLTGLLGLGSLSWAGHQVHRSHFPSFAEGATPFFTLN… |
| Q1MX23 | 150-463 | GPEGKLAPTGLSFDMFGPITPASMAGNHVAFGAVFFLGGIFHYFAGFNTKKFAFFEKDWEAVLSVSCQVLAFHFATVVFAMIIWQHP… |
| A0A2J6MDN1 | 4-469 | None |
| A0A2G2XBU1 | 4-376 | None |
| A0A7J9KJ29 | 21-368 | None |
| A0A1R3KZI6 | 7-314 | None |
| A0A6S7N825 | 3-322 | None |
| K7X1M8 | 8-475 | None |
| A0A396I1Z4 | 1-319 | None |
| A0A2G3CRL2 | 31-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.